ABflo[R] 647 Rabbit anti-Human CD337/NKp30 monoclonal antibody

Size

POA

SKU:: A23736
Additional Names:: 1C7|CD337|LY117|MALS|natural cytotoxicity triggering receptor 3|NCR3|NKp30
Application:: Flow Cytometry, IF, ICC
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Uniprot:: O14931
Synonyms:: 1C7;activating natural killer receptor p30;activating NK-A1 receptor;CD337;LY117;lymphocyte antigen 117;MALS;natural cytotoxicity triggering receptor 3;natural killer cell p30-related protein;NK-p30;NKp30
Extra Details:: The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.