A23694
CD55 Rabbit monoclonal antibody
Size
POA
- SKU:
- A23694
- Additional Names:
- CD55|Daf|Daf-GPI|Daf1|GPI-DAF
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNT
- Uniprot:
- Q61475
- Synonyms:
- CD55 antigen;CD55 molecule, decay accelerating factor for complement (Cromer blood group);CHAPLE;complement decay-accelerating factor;complement decay-accelerating factor, GPI-anchored;complement-glycosylphosphatidylinositol;CR;CROM;Cromer blood group;Cromer blood group antigen;DAF;Daf-;Daf-GPI;Daf1;decay accelerating factor 1;GPI anchor addition signal;GPI-;GPI-DAF;Rh blood group D antigen;TC
- Extra Details:
- This gene encodes an inhibitor of both the classical and the alternative pathways of complement activation. The encoded preproprotein undergoes post-translational processing to generate a mature polypeptide anchored to the plasma membrane via a glycosylphosphatidylinositol moiety. Erythrocytes from mice deficient in the encoded protein exhibit impaired regulation of complement activation resulting in enhanced complement deposition. Mice lacking the encoded protein exhibit enhanced susceptibility to experimentally induced myasthenia gravis. This gene is located adjacent to a closely related gene on chromosome 1.
- Shipping Conditions:
- Blue Ice