TLE4 Rabbit monoclonal antibody

Size

POA

SKU:: A23693
Additional Names:: BCE-1|BCE1|E(spI)|E(spl)|ESG|ESG4|Grg-4|GRG4|TLE4
Application:: ELISA, WB
Molecular Weight:: 84kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHL
Uniprot:: Q04727
Synonyms:: B lymphocyte gene 1;BCE-1;BCE1;E(spI);E(spl);enhancer of split groucho 4;ESG;ESG4;Grg-4;GRG4;groucho-related protein 4;transducin like enhancer of split 4;transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila);transducin-like enhancer of split 4, homolog of Drosophila E(sp1);transducin-like enhancer protein 4
Extra Details:: Predicted to enable transcription corepressor activity. Predicted to be involved in negative regulation of canonical Wnt signaling pathway. Predicted to act upstream of or within Wnt signaling pathway; cellular response to leukemia inhibitory factor; and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm. Part of beta-catenin-TCF complex.