Lyve1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23673
Additional Names:: 1200012G08Rik|Crsbp-1|Lyve-1|Lyve1|Xlkd1
Application:: ELISA, WB
Molecular Weight:: 50-70kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAG
Uniprot:: Q8BHC0
Synonyms:: 1200012G08Rik;cell surface retention sequence binding protein-1;Cell surface retention sequence-binding protein 1;Crsbp-1;extra cellular link domain-containing 1;extracellular link domain-containing protein 1;lymphatic vessel endothelial HA receptor-1;lymphatic vessel endothelial HA recptor-1;lymphatic vessel endothelial hyaluronic acid receptor 1;Lyve;Lyve-1;Xlkd;Xlkd1
Extra Details:: Enables hyaluronic acid binding activity and transmembrane signaling receptor activity. Acts upstream of or within glycosaminoglycan catabolic process. Located in plasma membrane. Is expressed in several structures, including cardiovascular system; gut; hemolymphoid system; meninges; and metanephros. Orthologous to human LYVE1 (lymphatic vessel endothelial hyaluronan receptor 1).