A23670
GPT2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A23670
- Additional Names:
- ALT2|GPT 2|GPT2|MRT49|NEDSPM
- Application:
- ELISA, WB
- Molecular Weight:
- 58 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVL
- Uniprot:
- Q8TD30
- Synonyms:
- alanine aminotransferase 2;ALT2;glutamate pyruvate transaminase 2;glutamic pyruvate transaminase (alanine aminotransferase) 2;glutamic pyruvate transaminase 2;glutamic--alanine transaminase 2;Glutamic--pyruvic transaminase 2;GPT 2;MRT49;NEDSPM
- Extra Details:
- This gene encodes a mitochondrial alanine transaminase, a pyridoxal enzyme that catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate. Alanine transaminases play roles in gluconeogenesis and amino acid metabolism in many tissues including skeletal muscle, kidney, and liver. Activating transcription factor 4 upregulates this gene under metabolic stress conditions in hepatocyte cell lines. A loss of function mutation in this gene has been associated with developmental encephalopathy. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice