IL22 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23665
Additional Names:: If2b1|IL-22|IL-22a|IL22|Iltif|ILTIFa
Application:: ELISA, WB
Molecular Weight:: 16kDa/18kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Uniprot:: Q9JJY9
Synonyms:: If2b1;Il;IL-;IL-10-related T-cell-derived-inducible factor;IL-22;IL-22a;IL-TIF alpha;Iltif;ILTIF alpha;ILTIFa;interferon 2b1;interleukin 10-related T cell-derived inducible factor;interleukin-22;interleukin-22a
Extra Details:: Predicted to enable cytokine activity. Acts upstream of or within several processes, including negative regulation of inflammatory response; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Predicted to be located in extracellular space. Is expressed in retina and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).