Chek2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23664
Additional Names:: Cds1|Chek2|CHK2|HUCDS1|Rad53
Application:: ELISA, WB
Molecular Weight:: 62-68kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKSHHQSHSSTSSKAHDSASCSQSQGGFSQPQGTPSQLHELSQYQGSSSSSTGTVPSSSQSSHSSSGTLSSLETVSTQELCSIPEDQEPEEPGPAPWARLWALQDGFSNLDCVNDNYWFGRDKSCEYCFDGPLLRRTDKYRTYSKKHFRIFREMGPKNCYIVYIEDHSGNGTFVNTELIGKGKRCPLSNNSEIALSLCRNKVFVFFDLTVDDQSV
Uniprot:: Q9Z265
Synonyms:: Cds1;Cds1 homolog;Checkpoint kinase 2;CHK2;CHK2 checkpoint homolog;HUCDS1;Rad;Rad53;Rad53 homolog;serine/threonine-protein kinase Chk2
Extra Details:: Enables protein kinase activity. Acts upstream of or within cellular response to gamma radiation; peptidyl-serine phosphorylation; and signal transduction by p53 class mediator. Predicted to be located in Golgi apparatus and PML body. Predicted to be active in cytoplasm and nucleus. Predicted to colocalize with chromosome, telomeric region. Is expressed in several structures, including central nervous system; genitourinary system; and liver. Human ortholog(s) of this gene implicated in several diseases, including Li-Fraumeni syndrome 2; breast cancer (multiple); colorectal cancer; osteosarcoma; and prostate cancer. Orthologous to human CHEK2 (checkpoint kinase 2).

Shipping Conditions:: Blue Ice