CD97 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23662
Additional Names:: Cd97|TM7LN1
Application:: ELISA, WB
Molecular Weight:: 90kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QKAESKNCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQASVNTGMTPVPSRIHTVTTAPGNLPEQTTTVHQTQMGDSEERTPKDVNECISGQNHCHQSTHCINKLGGYSCICRQGWKPVPGSPNGPVSTVCEDVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQEPPF
Uniprot:: Q9Z0M6
Synonyms:: AA409984;adhesion G protein-coupled receptor E5;CD97;CD97 antigen;CD97 molecule;EGF-TM7 receptor;leukocyte antigen CD97;seven transmembrane helix receptor;seven-span transmembrane protein;seven-transmembrane, heterodimeric receptor associated with inflammation;TM7LN1
Extra Details:: Predicted to enable G protein-coupled receptor activity and chondroitin sulfate binding activity. Acts upstream of or within positive regulation of synapse assembly. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; eye; genitourinary system; gut; and immune system. Human ortholog(s) of this gene implicated in vibratory urticaria. Orthologous to several human genes including ADGRE5 (adhesion G protein-coupled receptor E5).

Shipping Conditions:: Blue Ice