A23659
CD90.1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A23659
- Additional Names:
- CD90|CD90.1|T25|Thy-1|Thy-1.2|Thy1.1|Thy1.2
- Application:
- ELISA, WB
- Molecular Weight:
- 18-22kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKS
- Uniprot:
- P01831
- Synonyms:
- CD90;CDw90;T25;Thy-1;thy-1 antigen;thy-1 membrane glycoprotein;Thy-1 T-cell antigen;Thy-1.2;Thy1.1;Thy1.2
- Extra Details:
- This gene encodes a glycoprotein that is anchored to the cell surface of thymocytes, neuronal and other cells through a glycosyl-phosphatidylinositol moiety. A soluble form of the encoded protein has also been detected in serum and cerebrospinal fluid. The encoded protein undergoes further processing to generate the mature protein which mediates cell-cell interactions to trigger downstream signaling pathways.
- Shipping Conditions:
- Blue Ice