A23656
MAPT Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A23656
- Additional Names:
- MAPT|Mtapt|PHF-tau|Tau
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 50-80 kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTPNQEDQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLD
- Uniprot:
- P10637
- Synonyms:
- AI413597;AW045860;DDPAC;FTDP-17;G protein beta1/gamma2 subunit-interacting factor 1;MAPTL;microtubule-associated protein tau;MSTD;Mta;Mtapt;MTBT1;MTBT2;neurofibrillary tangle protein;paired helical filament-tau;PHF-tau;PPND;PPP1R103;protein phosphatase 1, regulatory subunit 103;Ta;TAU;tau-40
- Extra Details:
- Enables DNA binding activity; microtubule binding activity; and protein kinase binding activity. Involved in negative regulation of tubulin deacetylation; regulation of cellular response to heat; and regulation of response to DNA damage stimulus. Acts upstream of or within several processes, including adult walking behavior; generation of neurons; and transport along microtubule. Located in several cellular components, including cytoskeleton; glial cell projection; and postsynaptic density. Is expressed in several structures, including gut; nervous system; sensory organ; smooth muscle tissue; and urinary system. Used to study Alzheimer's disease. Human ortholog(s) of this gene implicated in dementia (multiple); neurodegenerative disease (multiple); progressive supranuclear palsy; and temporal lobe epilepsy. Orthologous to human MAPT (microtubule associated protein tau).
- Shipping Conditions:
- Blue Ice