Epcam Rabbit polyclonal antibody

Size

£152.00

SKU:: A23654
Additional Names:: CD326|EGP|EGP-2|Egp314|Ep-CAM|Epcam|EpCAM1|GA733-2|gp40|Ly74|Tacsd1|Tacstd1|TROP1
Application:: ELISA, WB
Molecular Weight:: 35-40kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Uniprot:: Q99JW5
Synonyms:: CD326;EGP;EGP-;EGP-2;Egp31;Egp314;Ep-C;Ep-CAM;EpC;EpCA;EpCAM1;epithelial cell adhesion molecule;epithelial glycoprotein 314;GA733-;GA733-2;gp4;gp40;Ly7;Ly74;lymphocyte antigen 74;mEGP314;panepithelial glycoprotein 314;protein 289A;Tacsd1;Tacst;Tacstd1;TR;Trop-1 protein;TROP1;tumor-associated calcium signal transducer 1
Extra Details:: Predicted to enable cadherin binding activity involved in cell-cell adhesion. Acts upstream of or within ureteric bud development. Located in cell surface. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Used to study congenital diarrhea 5 with tufting enteropathy. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule).

Shipping Conditions:: Blue Ice