CD119 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23652
Additional Names:: CD119|Ifgr|IFN-gammaR|Ifngr|Nktar
Application:: ELISA, WB
Molecular Weight:: 70-95kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDD
Uniprot:: P15261
Synonyms:: CD119;If;Ifgr;IFN-g;IFN-gamma receptor 1;IFN-gamma-R-alpha;IFN-gamma-R1;IFN-gammaR;Ifngr;INF-g receptor;interferon gamma receptor 1;interferon gamma receptor alpha-chain;Nk;Nktar
Extra Details:: Predicted to enable cytokine receptor activity. Involved in several processes, including astrocyte activation; negative regulation of amyloid-beta clearance; and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in several cellular components, including dendrite; endoplasmic reticulum; and postsynaptic density. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system; cerebral cortex; cranium; female reproductive system; and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma; hepatitis B; immunodeficiency 27A; immunodeficiency 27B; and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1).

Shipping Conditions:: Blue Ice