Hmox1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23650
Additional Names:: D8Wsu38e|Hemox|Hmox|Hmox1|HO-1|HO1|Hsp32
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 30kDa/35kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT
Uniprot:: P14901
Synonyms:: D8Wsu38;D8Wsu38e;heme oxygenase (decycling) 1;heme oxygenase 1;Hemox;hemoxygenase;Hmo;Hmox;HO;HO-;HO-1;HO1;Hsp;Hsp32;P32 protein
Extra Details:: Predicted to enable several functions, including heme binding activity; heme oxygenase (decyclizing) activity; and protein homodimerization activity. Acts upstream of or within several processes, including cellular response to cisplatin; cellular response to metal ion; and regulation of macroautophagy. Located in nucleus. Is expressed in several structures, including alimentary system; central nervous system; early conceptus; genitourinary system; and sensory organ. Used to study hemochromatosis and malaria. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); cerebrovascular disease (multiple); factor VIII deficiency; lung disease (multiple); and sickle cell anemia. Orthologous to human HMOX1 (heme oxygenase 1).

Shipping Conditions:: Blue Ice