A23641
Human IgG3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A23641
- Additional Names:
- Human IgG3|IgG3
- Application:
- ELISA, WB
- Molecular Weight:
- 68kDa/55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDT
- Uniprot:
- P01860
- Synonyms:
- C gamma 3;constant region of heavy chain of IgG3;HDC;Heavy chain disease protein;Ig gamma-3 chain C region;IgG3;immunoglobulin gamma 3 (Gm marker);immunoglobulin heavy constant gamma 3 (Gm marker);secrete-type Ig gamma heavy-chain
- Extra Details:
- Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in retina homeostasis. Located in blood microparticle and extracellular exosome.
- Shipping Conditions:
- Blue Ice

