A23597
TIMM13 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A23597
- Additional Names:
- ppv1|TIM13|TIM13B|TIMM13|TIMM13A|TIMM13B
- Application:
- ELISA, WB
- Molecular Weight:
- 11kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
- Uniprot:
- Q9Y5L4
- Synonyms:
- mitochondrial import inner membrane translocase subunit Tim13;mitochondrial import inner membrane translocase subunit Tim13B;ppv1;TIM13;TIM13B;TIMM13A;TIMM13B;translocase of inner mitochondrial membrane 13 homolog
- Extra Details:
- This gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of this family play a role in collecting substrate proteins from the translocase of the outer mitochondrial membrane (TOM) complex and delivering them to either the sorting and assembly machinery in the outer mitochondrial membrane (SAM) complex or the TIMM22 complex in the inner mitochondrial membrane. The encoded protein and the translocase of mitochondrial inner membrane 8a protein form a 70 kDa complex in the intermembrane space.
- Shipping Conditions:
- Blue Ice