A23595
IVD Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A23595
- Additional Names:
- ACAD2|IVD|IVDH
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HSLLPVDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLCINQLVRNGNEAQKEKYLPKLISGE
- Uniprot:
- P26440
- Synonyms:
- ACAD2;butyryl-CoA dehydrogenase;epididymis secretory sperm binding protein;isovaleryl Coenzyme A dehydrogenase;isovaleryl-CoA dehydrogenase, mitochondrial;IVDH
- Extra Details:
- Isovaleryl-CoA dehydrogenase (IVD) is a mitochondrial matrix enzyme that catalyzes the third step in leucine catabolism. The genetic deficiency of IVD results in an accumulation of isovaleric acid, which is toxic to the central nervous system and leads to isovaleric acidemia. Alternatively spliced transcript variants have been found for this gene.
- Shipping Conditions:
- Blue Ice

