ABflo[R] 488 Rabbit anti-Mouse CD117/c-Kit monoclonal antibody

Size

POA

SKU:: A23581
Additional Names:: Bs|c-KIT|CD117|Fdc|Gsfsco1|Gsfsco5|Gsfsow3|SCO1|SCO5|SOW3|Ssm|Tr-kit|W
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT
Uniprot:: P05532
Synonyms:: belly;belly-spot;Bs;c-KI;C-Kit;c-kit proto-oncogene protein;c-Kit protooncogene;CD117;dominant spotting;Dominant white spotting;Fdc;Gsfs;Gsfsco1;Gsfsco5;Gsfsow3;kit oncogene;mast/stem cell growth factor receptor Kit;MASTC;p145 c-kit;PBT;piebald trait protein;proto-oncogene c-Kit;proto-oncogene tyrosine-protein kinase Kit;SC;SCFR;SCO1;SCO5;SO;soluble KIT variant 1;SOW3;spotted sterile male;Ssm;Steel Factor Receptor;Tr-k;Tr-kit;tyrosine-protein kinase Kit;v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog;v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein;W
Extra Details:: The c-Kit proto-oncogene is the cellular homolog of the transforming gene of a feline retrovirus (v-Kit). The c-kit protein includes characteristics of a protein kinase transmembrane receptor. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice