A23575
Ube1L / UBA7 Rabbit monoclonal antibody
Size
POA
- SKU:
- A23575
- Additional Names:
- D8|UBA1B|UBE1L|Ube1L / UBA7|UBE2|UBE7
- Application:
- ELISA, WB
- Molecular Weight:
- 110-118kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDALDASKLLDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCWSDLAAQFLLSEQDLERSRAEASQELLAQLNR
- Uniprot:
- P41226
- Synonyms:
- D8;UBA1, ubiquitin-activating enzyme E1 homolog B;UBA1B;UBA7, ubiquitin-activating enzyme E1;UBE1L;UBE2;ubiquitin-activating enzyme 7;ubiquitin-activating enzyme E1 homolog;ubiquitin-activating enzyme E1-related protein;ubiquitin-activating enzyme-2;ubiquitin-like modifier-activating enzyme 7
- Extra Details:
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme is a retinoid target that triggers promyelocytic leukemia (PML)/retinoic acid receptor alpha (RARalpha) degradation and apoptosis in acute promyelocytic leukemia, where it is involved in the conjugation of the ubiquitin-like interferon-stimulated gene 15 protein.
- Shipping Conditions:
- Blue Ice