Cathepsin H Rabbit monoclonal antibody

Size

POA

SKU:: A23573
Additional Names:: ACC-4|ACC-5|ACC4|ACC5|Cathepsin H|CPSB
Application:: ELISA, WB
Molecular Weight:: 28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVS
Uniprot:: P09668
Synonyms:: ACC-4;ACC-5;ACC4;ACC5;aleurain;cathepsin B3;cathepsin BA;CPSB;N-benzoylarginine-beta-naphthylamide hydrolase;pro-cathepsin H
Extra Details:: The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.