A23566
Palladin Rabbit monoclonal antibody
Size
POA
- SKU:
- A23566
- Additional Names:
- CGI-151|CGI151|MYN|Palladin|PNCA1|SIH002
- Application:
- ELISA, WB
- Molecular Weight:
- 140kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDSEKEISQIFSTSPASLCEHPSHKETKLGEHASRRPQDNRST
- Uniprot:
- Q8WX93
- Synonyms:
- CGI-151;CGI151;MYN;myoneurin;palladin;PNCA1;sarcoma antigen NY-SAR-77;SIH002
- Extra Details:
- This gene encodes a cytoskeletal protein that is required for organizing the actin cytoskeleton. The protein is a component of actin-containing microfilaments, and it is involved in the control of cell shape, adhesion, and contraction. Polymorphisms in this gene are associated with a susceptibility to pancreatic cancer type 1, and also with a risk for myocardial infarction. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice