A23565
HRPT2 / CDC73 Rabbit monoclonal antibody
Size
POA
- SKU:
- A23565
- Additional Names:
- C1orf28|FIHP|HPTJT|HRPT1|HRPT2|HRPT2 / CDC73|HYX
- Application:
- ELISA, WB
- Molecular Weight:
- 61 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRE
- Uniprot:
- Q6P1J9
- Synonyms:
- C1orf28;cell division cycle 73 Paf1/RNA polymerase II complex component-like protein;cell division cycle 73, Paf1/RNA polymerase II complex component, homolog;cell division cycle protein 73 homolog;Familial isolated hyperparathyroidism;FIHP;HPTJT;HRPT1;HRPT2;hyperparathyroidism 2 protein;HYX;Paf1/RNA polymerase II complex component;parafibromin
- Extra Details:
- This gene encodes a tumor suppressor that is involved in transcriptional and post-transcriptional control pathways. The protein is a component of the the PAF protein complex, which associates with the RNA polymerase II subunit POLR2A and with a histone methyltransferase complex. This protein appears to facilitate the association of 3' mRNA processing factors with actively-transcribed chromatin. Mutations in this gene have been linked to hyperparathyroidism-jaw tumor syndrome, familial isolated hyperparathyroidism, and parathyroid carcinoma.
- Shipping Conditions:
- Blue Ice