RAB22A Rabbit monoclonal antibody

Size

POA

SKU:: A23564
Additional Names:: RAB22A|ras-related protein Rab-22A
Application:: ELISA, WB, IP
Molecular Weight:: 22 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWV
Uniprot:: Q9UL26
Synonyms:: GTP-binding protein RAB22A;rab-22;ras-related protein Rab-22A
Extra Details:: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments.