A23556
NR2C2 / TR4 Rabbit monoclonal antibody
Size
POA
- SKU:
- A23556
- Additional Names:
- NR2C2 / TR4|TAK1|TR4
- Application:
- ELISA, WB
- Molecular Weight:
- 67kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSS
- Uniprot:
- P49116
- Synonyms:
- Nuclear hormone receptor TR4;nuclear receptor subfamily 2 group C member 2;orphan nuclear receptor TAK1;orphan nuclear receptor TR4;orphan receptor TR4;TAK1;testicular nuclear receptor 4;Testicular receptor 4;TR4
- Extra Details:
- This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice