CHD4 Rabbit monoclonal antibody

Size

POA

SKU:: A23537
Additional Names:: CHD-4|CHD4|Mi-2b|Mi2-BETA|SIHIWES
Application:: ELISA, WB, IHC-P
Molecular Weight:: 260kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNI
Uniprot:: Q14839
Synonyms:: ATP-dependent helicase CHD4;CHD-4;chromodomain-helicase-DNA-binding protein 4;Mi-2 autoantigen 218 kDa protein;Mi-2b;Mi2-BETA;SIHIWES
Extra Details:: The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.