Mitofilin Rabbit monoclonal antibody

Size

POA

SKU:: A23530
Additional Names:: HMP|Mic60|MICOS60|MINOS2|Mitofilin|P87|P87/89|P89|PIG4|PIG52
Application:: ELISA, WB, IHC-P, IP
Molecular Weight:: 90 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKE
Uniprot:: Q16891
Synonyms:: cell proliferation-inducing gene 4/52 protein;cell proliferation-inducing protein 52;heart muscle protein;HMP;Mic60;MICOS complex subunit MIC60;MICOS60;MINOS2;mitochondrial contact site and cristae organizing system subunit 60;mitochondrial inner membrane organizing system 2;mitochondrial inner membrane protein;mitofilin;motor protein;P87;P87/89;P89;PIG4;PIG52;proliferation-inducing gene 4
Extra Details:: Enables RNA binding activity. Involved in cristae formation. Located in mitochondrial inner membrane. Part of MICOS complex.