A23527
CD2 Rabbit monoclonal antibody
Size
POA
- SKU:
- A23527
- Additional Names:
- CD2|LFA-2|Ly-37|Ly37
- Application:
- ELISA, Flow Cytometry, WB
- Molecular Weight:
- 45-65kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS
- Uniprot:
- P08920
- Synonyms:
- CD2 antigen (p50), sheep red blood cell receptor;erythrocyte receptor;LFA;LFA-2;LFA-3 receptor;Ly-3;Ly-37;Ly3;Ly37;lymphocyte antigen 37;lymphocyte-function antigen-2;rosette receptor;SRBC;T-cell surface antigen CD2;T-cell surface antigen T11/Leu-5;T11
- Extra Details:
- Enables identical protein binding activity. Predicted to be involved in T cell activation; heterotypic cell-cell adhesion; and positive regulation of cytokine production. Located in several cellular components, including cell-cell junction; cytoplasmic side of plasma membrane; and external side of plasma membrane. Is anchored component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD2 (CD2 molecule).
- Shipping Conditions:
- Blue Ice