A2352
Histone H3 Rabbit polyclonal antibody

Size
POA
- SKU:
- A2352
- Additional Names:
- H3.4|H3/g|H3C16|H3FT|H3t|HIST3H3|Histone H3
- Application:
- ChIP, ELISA, WB, IHC-P, IP
- Molecular Weight:
- 17 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
- Uniprot:
- P68431, Q16695
- Synonyms:
- H3 histone family, member A;H3 histone family, member B;H3 histone family, member C;H3 histone family, member D;H3 histone family, member F;H3 histone family, member H;H3 histone family, member I;H3 histone family, member J;H3 histone family, member K;H3 histone family, member L;H3 histone family, member T;H3.1;H3.4;H3.f;H3/A;H3/b;H3/c;H3/d;H3/f;H3/g;H3/h;H3/i;H3/j;H3/k;H3/l;H3/t;H3C1;H3C10;H3C11;H3C12;H3C2;H3C3;H3C4;H3C6;H3C7;H3C8;H3F1K;H3FA;H3FB;H3FC;H3FD;H3FF;H3FH;H3FI;H3FJ;H3FK;H3FL;H3FT;H3t;HIST1H3A;HIST1H3B;HIST1H3C;HIST1H3D;HIST1H3E;HIST1H3F;HIST1H3G;HIST1H3H;HIST1H3I;HIST1H3J;HIST3H3;histone 1, H3a;histone 1, H3b;histone 1, H3c;histone 1, H3d;histone 1, H3e;histone 1, H3f;histone 1, H3g;histone 1, H3h;histone 1, H3i;histone 1, H3j;histone 3, H3;histone cluster 1 H3 family member a;histone cluster 1 H3 family member b;histone cluster 1 H3 family member c;histone cluster 1 H3 family member d;histone cluster 1 H3 family member e;histone cluster 1 H3 family member f;histone cluster 1 H3 family member g;histone cluster 1 H3 family member h;histone cluster 1 H3 family member i;histone cluster 1 H3 family member j;histone cluster 1, H3a;histone cluster 1, H3b;histone cluster 1, H3c;histone cluster 1, H3d;histone cluster 1, H3e;histone cluster 1, H3f;histone cluster 1, H3g;histone cluster 1, H3h;histone cluster 1, H3i;histone cluster 1, H3j;histone cluster 3 H3;histone H3.1;histone H3.1t;histone H3.4;histone H3/a;histone H3/b;histone H3/c;histone H3/d;histone H3/f;histone H3/h;histone H3/i;histone H3/j;histone H3/k;histone H3/l
- Extra Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
- Shipping Conditions:
- Blue Ice








