[KO Validated] eEF1A1 Rabbit monoclonal antibody

Size

POA

SKU:: A23515
Additional Names:: CCS-3|CCS3|EE1A1|EEF-1|EEF1A|eEF1A-1|eEF1A1|EF-Tu|EF1A|EF1A1|EF1alpha1|GRAF-1EF|LENG7|PTI1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 50 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA
Uniprot:: P68104
Synonyms:: CCS-3;CCS3;cervical cancer suppressor 3;CTCL tumor antigen;EE1A1;EEF-1;EEF1A;eEF1A-1;EF-1-alpha-1;EF-Tu;EF1A;EF1a-like protein;elongation factor 1 alpha subunit;elongation factor 1-alpha 1;elongation factor Tu;epididymis secretory sperm binding protein;eukaryotic elongation factor 1 A-1;eukaryotic translation elongation factor 1 alpha 1-like 14;glucocorticoid receptor AF-1 specific elongation factor;GRAF-1EF;LENG7;leukocyte receptor cluster (LRC) member 7;leukocyte receptor cluster member 7;prostate tumor-inducing protein 1;PTI1;translation elongation factor 1 alpha 1-like 14
Extra Details:: This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes.

Shipping Conditions:: Blue Ice