A23440
Sarm1 Mouse monoclonal antibody
Size
POA
- SKU:
- A23440
- Additional Names:
- A830091I15Rik|MyD885|Sarm|Sarm1
- Application:
- ELISA, WB
- Molecular Weight:
- 73kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Mouse
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTEVQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVE
- Uniprot:
- Q6PDS3
- Synonyms:
- A830091I15Rik;C78606;hSARM1;HsTIR;MyD88-5;MyD885;NAD(+) hydrolase SARM1;NADase SARM1;NADP(+) hydrolase SARM1;SAM domain-containing protein 2;SAMD2;SARM;sterile alpha and Armadillo repeat protein;sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila;sterile alpha and TIR motif containing 1;sterile alpha and TIR motif-containing protein 1;sterile alpha motif domain-containing protein 2;tir-1 homolog
- Extra Details:
- Enables NAD+ nucleosidase activity. Involved in NAD catabolic process; positive regulation of neuron death; and regulation of dendrite morphogenesis. Acts upstream of or within regulation of apoptotic process and response to glucose. Located in several cellular components, including dendrite; microtubule; and mitochondrion. Is extrinsic component of mitochondrial outer membrane. Is expressed in immune system; nervous system; neural retina; and tongue. Orthologous to human SARM1 (sterile alpha and TIR motif containing 1).
- Shipping Conditions:
- Blue Ice