A2344
Uhrf2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2344
- Additional Names:
- 2310065A22Rik|D130071B19Rik|Nirf|Uhrf2
- Application:
- ELISA, WB
- Molecular Weight:
- 95kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDPECDLCGGDPDKTCHMCSCHKCGEKRDPNM
- Uniprot:
- Q7TMI3
- Synonyms:
- 2310065A22Rik;AI426270;AW214556;D130071B19Rik;E3 ubiquitin-protein ligase UHRF2;N;Nirf;Np95-like ring finger protein;np95/ICBP90-like RING finger protein;nuclear protein 97;nuclear zinc finger protein Np97;RING finger protein 107;RING-type E3 ubiquitin transferase UHRF2;RNF107;TDRD23;ubiquitin-like PHD and RING finger domain-containing protein 2;ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase;ubiquitin-like-containing PHD and RING finger domains protein 2;ubiquitin-like, containing PHD and RING finger domains, 2;URF2
- Extra Details:
- Enables histone binding activity. Predicted to be involved in several processes, including maintenance of DNA methylation; protein autoubiquitination; and regulation of cell cycle. Located in heterochromatin and nucleus. Is expressed in several structures, including central nervous system; ear; early conceptus; female reproductive system; and urinary system. Orthologous to human UHRF2 (ubiquitin like with PHD and ring finger domains 2).
- Shipping Conditions:
- Blue Ice