A23305PM
CD8A Rabbit PolymAb[R]

Size
POA
- SKU:
- A23305PM
- Additional Names:
- CD8|CD8A|Leu2|MAL|p32
- Application:
- ELISA, IHC, WB, IHC-P, IF
- Molecular Weight:
- 40 kDa
- Species Reactivity:
- Human, Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Uniprot:
- P01731, P01732
- Synonyms:
- BB154331;CD8;CD8 antigen, alpha polypeptide (p32);Leu2;Leu2 T-lymphocyte antigen;Ly-;Ly-2;Ly-3;Ly-35;Ly-B;Lyt-;Lyt-2;Lyt-2.1 lymphocyte differentiation antigen (AA at 100);OKT8 T-cell antigen;p32;T cell co-receptor;T-cell antigen Leu2;T-cell surface glycoprotein CD8 alpha chain;T-cell surface glycoprotein Lyt-2;T-lymphocyte differentiation antigen T8/Leu-2;T8 T-cell antigen
- Extra Details:
- The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_1.jpg)
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_2.jpg)
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_3.jpg)
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_4.jpg)
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_5.jpg)
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_ARC59319-01_ARC55249-01_WB_01.jpg)
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_ARC59319-01_ARC55249-01_WB_02.jpg)
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_ARC59319-01_ARC55249-01_IHC_01.jpg)
![CD8A Rabbit PolymAb[R]](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23305PM/A23305PM_ARC59319-01_ARC55249-01_IHC_02.jpg)