A23289
VDR Rabbit monoclonal antibody
Size
POA
- SKU:
- A23289
- Additional Names:
- NR1I1|PPP1R163|VDR
- Application:
- ChIP, ELISA, WB, IHC-P, IF, ICC, IP
- Molecular Weight:
- 48 kDa/54 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEV
- Uniprot:
- P11473
- Synonyms:
- 1,25-dihydroxyvitamin D3 receptor;NR1I1;nuclear receptor subfamily 1 group I member 1;PPP1R163;protein phosphatase 1, regulatory subunit 163;vitamin D (1,25- dihydroxyvitamin D3) receptor;vitamin D nuclear receptor variant 1;vitamin D3 receptor;vitamin D3 receptor isoform VDRA
- Extra Details:
- This gene encodes vitamin D3 receptor, which is a member of the nuclear hormone receptor superfamily of ligand-inducible transcription factors. This receptor also functions as a receptor for the secondary bile acid, lithocholic acid. Downstream targets of vitamin D3 receptor are principally involved in mineral metabolism, though this receptor regulates a variety of other metabolic pathways, such as those involved in immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
- Shipping Conditions:
- Blue Ice