A23260
CD107b Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A23260
- Additional Names:
- CD107b|Lamp II|Lamp-2|Lamp-2a|Lamp-2b|Lamp-2c|LGP-B|Mac3
- Application:
- ELISA, WB
- Molecular Weight:
- 102kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQ
- Uniprot:
- P17047
- Synonyms:
- CD107 antigen-like family member B;CD107b;DND;Lam;Lamp;Lamp II;LAMP-2;Lamp-2a;Lamp-2b;Lamp-2c;LAMPB;LGP-96;LGP-B;LGP110;lysosomal membrane glycoprotein 2;lysosomal membrane glycoprotein type B;lysosome-associated membrane glycoprotein 2;Mac;Mac3
- Extra Details:
- Enables protein domain specific binding activity. Involved in several processes, including autophagosome maturation; protein stabilization; and protein targeting to lysosome involved in chaperone-mediated autophagy. Acts upstream of or within muscle cell cellular homeostasis. Located in late endosome membrane; lysosomal membrane; and phagocytic vesicle membrane. Is integral component of autophagosome membrane. Is expressed in central nervous system; egg cylinder; lung; and retina. Used to study Danon disease. Human ortholog(s) of this gene implicated in Danon disease and hypertrophic cardiomyopathy. Orthologous to human LAMP2 (lysosomal associated membrane protein 2).
- Shipping Conditions:
- Blue Ice

