CD11b Rabbit polyclonal antibody

Size

£152.00

SKU:: A23254
Additional Names:: Cd11b|CD11b/CD18|CR3|CR3A|F730045J24Rik|Ly-40|Mac-1|Mac-1a|MAC1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 170kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQFKKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFHKTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRRELDTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEG
Uniprot:: P05555
Synonyms:: CD11 antigen-like family member B;Cd11b;CD11B (p170);CD11b/CD18;cell surface glycoprotein MAC-1 alpha subunit;cell surface glycoprotein MAC-1 subunit alpha;complement receptor type 3;CR;CR-3 alpha chain;CR3;CR3A;F730045J24Rik;integrin alpha-M;leukocyte adhesion receptor MO1;Ly-4;Ly-40;Mac-;Mac-1;Mac-1 alpha;Mac-1a;MAC1;macrophage antigen alpha
Extra Details:: Enables complement component C3b binding activity; heparan sulfate proteoglycan binding activity; and heparin binding activity. Contributes to cargo receptor activity. Involved in several processes, including central nervous system development; endocytosis; and positive regulation of neuron death. Acts upstream of or within several processes, including activated T cell proliferation; leukocyte migration; and microglia development. Located in external side of plasma membrane and nucleus. Is integral component of membrane. Part of integrin alphaM-beta2 complex. Is expressed in several structures, including central nervous system; heart; lymphatic vessel; thymus; and yolk sac. Human ortholog(s) of this gene implicated in lupus nephritis. Orthologous to human ITGAM (integrin subunit alpha M).

Shipping Conditions:: Blue Ice