A23235
KPNB1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A23235
- Additional Names:
- IMB1|Impnb|IPO1|IPOB|KPNB1|NTF97
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 97kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPS
- Uniprot:
- Q14974
- Synonyms:
- IMB1;Impnb;importin 1;importin 90;importin beta-1 subunit;importin subunit beta-1;Importin-90;IPO1;IPOB;karyopherin (importin) beta 1;Karyopherin subunit beta-1;NTF97;nuclear factor p97;pore targeting complex 97 kDa subunit;PTAC97
- Extra Details:
- Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice








