[KD Validated] GALC Rabbit monoclonal antibody

Size

POA

SKU:: A23229
Additional Names:: galactocerebrosidase|GALC
Application:: ELISA, WB, IHC-P
Molecular Weight:: 80kDa/50kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
ABP:: IMP-GEN-14-02 < 3%
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GGAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGY
Uniprot:: P54803
Synonyms:: galactocerebrosidase;galactocerebroside beta-galactosidase;Galactosylceramidase;galactosylceramide beta-galactosidase;galactosylceraminidase;GALCERase;testis tissue sperm-binding protein Li 88E;testis tissue sperm-binding protein Li 89A
Extra Details:: This gene encodes a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.