Human IgE Rabbit monoclonal antibody

Size

POA

SKU:: A23194
Additional Names:: Human IgE|Igh2|IGHE|IGHEP1
Application:: ELISA, Flow Cytometry, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGL
Uniprot:: P01854
Synonyms:: constant region of heavy chain of IgE;Ig epsilon chain C region;Ig epsilon chain C region ND;IgE;immunoglobulin epsilon
Extra Details:: IgE is the class of antibodies produced in the lungs, skin, and mucous membranes. It may protect against parasite invasion, but it is a major factor in allergic reactions. The antigen-specific IgE interacts with mast cells and eosinophils, triggers the release of histamine, leukotrienes and other substances that lead to the itching, sneezing and congestion of allergies - and the life threatening respiratory distress of asthma and anaphylactic shock