A23166
[KD Validated] BRD2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A23166
- Additional Names:
- BRD2|BRD2-IT1|D6S113E|FSH|FSHRG1|FSRG1|NAT|O27.1.1|RING3|RNF3
- Application:
- ELISA, WB
- Molecular Weight:
- 112kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGK
- Uniprot:
- P25440
- Synonyms:
- BRD2 intronic transcript 1;BRD2-IT1;bromodomain-containing protein 2;D6S113E;female sterile homeotic-related gene 1;FSH;FSRG1;NAT;O27.1.1;really interesting new gene 3 protein;RING3;RNF3
- Extra Details:
- This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatibility complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene.
- Shipping Conditions:
- Blue Ice
![[KD Validated] BRD2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23166/A23166_1.jpg)
![[KD Validated] BRD2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23166/A23166_ARC56992-01_WB_01.jpg)
![[KD Validated] BRD2 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A23166/A23166_ARC56992-01_WB_02.jpg)