PLA2R1 Rabbit monoclonal antibody

Size

POA

SKU:: A23148
Additional Names:: CLEC13C|PLA2-R|PLA2G1R|PLA2IR|PLA2R|PLA2R1
Application:: ELISA, WB
Molecular Weight:: 180 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YQYDVPWLFYQDAEYLFHTFASEWLNFEFVCSWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWDTGRERTVNNQ
Uniprot:: Q13018
Synonyms:: 180 kDa secretory phospholipase A2 receptor;C-type lectin domain family 13 member C;CLEC13C;M-type receptor;phospholipase A2 receptor 1, 180kD;phospholipase A2 receptor 1, 180kDa;PLA2-R;PLA2G1R;PLA2IR;PLA2R;secretory phospholipase A2 receptor
Extra Details:: This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms at this locus have been associated with susceptibility to idiopathic membranous nephropathy. Alternatively spliced transcript variants encoding different isoforms have been identified.