A23146
CYP39A1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A23146
- Application:
- ELISA, WB
- Molecular Weight:
- 54kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIPSGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSF
- Uniprot:
- Q9NYL5
- Synonyms:
- 24-hydroxycholesterol 7-alpha-hydroxylase;Cytochrome P450 39A1;cytochrome P450, family 39, subfamily A, polypeptide 1;cytochrome P450, subfamily XXXIX (oxysterol 7 alpha-hydroxylase), polypeptide 1;Oxysterol 7-alpha-hydroxylase
- Extra Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is involved in the conversion of cholesterol to bile acids. Its substrates include the oxysterols 25-hydroxycholesterol, 27-hydroxycholesterol and 24-hydroxycholesterol. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

