A23127
SOX5 Rabbit monoclonal antibody

Size
POA
- SKU:
- A23127
- Additional Names:
- L-SOX5|L-SOX5B|L-SOX5F|LAMSHF|SOX5
- Application:
- ELISA, WB
- Molecular Weight:
- 84 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLTDPDLPQEFERMSSKRPASPYGEADGEVAMVTSRQKVEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSS
- Uniprot:
- P35711
- Synonyms:
- L-SOX5;L-SOX5B;L-SOX5F;LAMSHF;SRY (sex determining region Y)-box 5;SRY-box 5;transcription factor SOX-5
- Extra Details:
- This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
- Shipping Conditions:
- Blue Ice



