YOD1 Rabbit monoclonal antibody

Size

POA

SKU:: A23071
Additional Names:: DUBA8|OTUD2|PRO0907|YOD1
Application:: ELISA, WB
Molecular Weight:: 38 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
Uniprot:: Q5VVQ6
Synonyms:: DUBA-8;DUBA8;HIN-7;HIV-1-induced protease 7;hsHIN7;OTU domain containing 2;OTU domain-containing protein 2;OTUD2;PRO0907;ubiquitin thioesterase OTU1;YOD1 OTU deubiquinating enzyme 1 homolog ( yeast)
Extra Details:: Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. The protein encoded by this gene belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain. Alternative splicing results in multiple transcript variants.