[KD Validated] ME1 Rabbit polyclonal antibody

Size

POA

SKU:: A23068
Additional Names:: [KD Validated] ME1|HUMNDME|MES
Application:: ELISA, WB
Molecular Weight:: 64kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
Uniprot:: P48163
Synonyms:: HUMNDME;malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+));Malic enzyme 1;malic enzyme 1, NADP(+)-dependent, cytosolic;malic enzyme 1, soluble;Malic enzyme, cytoplasmic;MES;NADP-dependent malic enzyme;NADP-ME;pyruvic-malic carboxylase
Extra Details:: This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.