A23056
RYR1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A23056
- Additional Names:
- CCO|CMYP1A|CMYP1B|KDS|MHS|MHS1|PPP1R137|RYDR|RYR|RYR-1|RYR1|SKRR
- Application:
- ELISA, WB
- Molecular Weight:
- 565kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
- Uniprot:
- P21817
- Synonyms:
- CCO;central core disease of muscle;MHS;MHS1;PPP1R137;protein phosphatase 1, regulatory subunit 137;ryanodine receptor 1;ryanodine receptor 1 (skeletal);RYDR;RYR;RYR-1;sarcoplasmic reticulum calcium release channel;skeletal muscle calcium release channel;skeletal muscle ryanodine receptor;Skeletal muscle-type ryanodine receptor;SKRR;Type 1 ryanodine receptor;type 1-like ryanodine receptor
- Extra Details:
- This gene encodes a ryanodine receptor found in skeletal muscle. The encoded protein functions as a calcium release channel in the sarcoplasmic reticulum but also serves to connect the sarcoplasmic reticulum and transverse tubule. Mutations in this gene are associated with malignant hyperthermia susceptibility, central core disease, and minicore myopathy with external ophthalmoplegia. Alternatively spliced transcripts encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice