IL12B Rabbit polyclonal antibody

Size

£152.00

SKU:: A23054
Additional Names:: Il-12b|Il-12p40|IL12B|Il12p40|p40
Application:: ELISA, WB
Molecular Weight:: 38kda
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Uniprot:: P43432
Synonyms:: CLMF;CLMF p40;CLMF2;cytotoxic lymphocyte maturation factor 40 kDa subunit;Il-1;Il-12;IL-12 p40 subunit;IL-12 subunit p40;IL-12B;Il-12p40;IL-23 subunit p40;IL12, subunit p40;Il12p40;IMD28;IMD29;interleukin 12, p40;interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40);interleukin-12 beta chain;interleukin-12 p40 subunit;interleukin-12 subunit beta;natural killer cell stimulatory factor, 40 kD subunit;NK cell stimulatory factor chain 2;NKSF;NKSF2;p40
Extra Details:: This gene encodes the beta subunit p40 of the Interleukin 12 (IL-12) family of cytokines. Members of the IL-12 family form heterodimers consisting of heavy and light subunits linked by disulfide bonds. The product of this gene, p40, is a subunit of interleukins IL-12 and IL-23.

Shipping Conditions:: Blue Ice