CD103 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23053
Additional Names:: A530055J10|alpha-E1|alpha-M290|aM290|CD103
Application:: ELISA, WB
Molecular Weight:: 150kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EDGTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFECNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTASAMQHVLDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIGVGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLLSKLQQHIVHMEGT
Uniprot:: Q60677
Synonyms:: A530055J10;alph;alpha-E1;alpha-M290;aM290;CD103;integrin alpha M290;integrin alpha-E
Extra Details:: Predicted to enable metal ion binding activity. Predicted to act upstream of or within cell adhesion and integrin-mediated signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; genitourinary system; lymph node; nasal septum; and nucleus pulposus. Orthologous to human ITGAE (integrin subunit alpha E).