CD47 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23052
Additional Names:: 9130415E20Rik|B430305P08Rik|CD47|IAP|Itgp
Application:: ELISA, WB
Molecular Weight:: 45-60kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNT
Uniprot:: Q61735
Synonyms:: 9130415E20Rik;AA407862;AI848868;antigen identified by monoclonal antibody 1D8;antigenic surface determinant protein OA3;AW108519;B430305P08Rik;CD47 antigen (Rh-related antigen, integrin-associated signal transducer);CD47 glycoprotein;IAP;integrin associated protein;integrin-associated protein;integrin-associated signal transducer;It;Itgp;leukocyte surface antigen CD47;MER6;OA3;Rh-related antigen
Extra Details:: Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion and thrombospondin receptor activity. Involved in regulation of nitric oxide biosynthetic process. Acts upstream of or within several processes, including monocyte aggregation; opsonization; and positive regulation of phagocytosis. Located in extracellular exosome. Is integral component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD47 (CD47 molecule).

Shipping Conditions:: Blue Ice