A23046
Cleaved Gasdermin B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A23046
- Additional Names:
- Cleaved Gasdermin B|GSDMB-1|GSDML|PP4052|PRO2521
- Application:
- ELISA, WB
- Molecular Weight:
- 16kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHME
- Uniprot:
- Q8TAX9-6
- Synonyms:
- gasdermin-B;gasdermin-like protein;gasderminB-1;GSDMB-1;GSDML;PP4052;PRO2521
- Extra Details:
- This gene encodes a member of the gasdermin-domain containing protein family. Other gasdermin-family genes are implicated in the regulation of apoptosis in epithelial cells, and are linked to cancer. Alternative splicing and the use of alternative promoters results in multiple transcript variants. Additional variants have been described, but they are candidates for nonsense-mediated mRNA decay (NMD) and are unlikely to be protein-coding.
- Shipping Conditions:
- Blue Ice