BTN2A1 Rabbit monoclonal antibody

Size

POA

SKU:: A23032
Additional Names:: BK14H9.1|BT2.1|BTF1|BTN2.1|BTN2A1|DJ3E1.1
Application:: ELISA, WB
Molecular Weight:: 69kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVS
Uniprot:: Q7KYR7
Synonyms:: BK14H9.1;BT2.1;BTF1;BTN2.1;butyrophilin subfamily 2 member A1;DJ3E1.1
Extra Details:: This gene encodes a member of the immunoglobulin superfamily. The gene is located in a cluster of butyrophilin-like genes in the juxta-telomeric region of the major histocompatibility complex on chromosome 6. A pseudogene of this gene has been identified in this cluster. The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations in this gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.