A23002
TrKC Rabbit monoclonal antibody
Size
POA
- SKU:
- A23002
- Additional Names:
- GP145-TrkC|gp145(trkC)|TRKC
- Application:
- ELISA, WB
- Molecular Weight:
- 100kDa/145kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDME
- Uniprot:
- Q16288
- Synonyms:
- ETS related protein-neurotrophic receptor tyrosine kinase fusion protein;ETV6-NTRK3 fusion;GP145-TrkC;gp145(trkC);Neurotrophic tyrosine kinase receptor type 3;neurotrophic tyrosine kinase, receptor, type 3;NT-3 growth factor receptor;TRKC;TrkC tyrosine kinase;tyrosine kinase receptor C
- Extra Details:
- This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice